PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G274900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 303aa    MW: 34544.1 Da    PI: 5.7416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G274900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-141459146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +g+W +eEde+l d+vk++G+++W++I ++  + Rt+k+c++rw +
  Aqcoe3G274900.1.p 14 KGPWMAEEDEILMDYVKKHGPRDWSSIRSKGLLPRTGKSCRLRWVN 59
                       79*************************8876677**********87 PP

2Myb_DNA-binding414.5e-1370110345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        ++++eE+   +d+ +++G++ W++Ia +++ gRt++++k++w 
  Aqcoe3G274900.1.p  70 KFSAEEERVVIDLQARFGNK-WARIATYLQ-GRTDNDVKNFWS 110
                        79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.09965IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-201262IPR009057Homeodomain-like
SuperFamilySSF466893.2E-2712109IPR009057Homeodomain-like
SMARTSM007172.4E-111363IPR001005SANT/Myb domain
PfamPF002493.7E-121459IPR001005SANT/Myb domain
CDDcd001673.74E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.9E-1763115IPR009057Homeodomain-like
PROSITE profilePS5129417.1666117IPR017930Myb domain
SMARTSM007171.1E-1067115IPR001005SANT/Myb domain
PfamPF002492.0E-1170110IPR001005SANT/Myb domain
CDDcd001671.79E-970109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMERRSREEM VMRKGPWMAE EDEILMDYVK KHGPRDWSSI RSKGLLPRTG KSCRLRWVNK  60
LKPDLKTGCK FSAEEERVVI DLQARFGNKW ARIATYLQGR TDNDVKNFWS TRQKRLARIL  120
QTSNQTKSQK NNGKAPASRQ VTTLEAPRPV SIAMEQSSSS QNQTCQLSYL ENPDVIKMVP  180
LPDLMNPGLF SLETNLPQLE FTPTEKPCTD PQPHFPFQLP HPTLDLPLLP ENQDLVPELG  240
DSNLMDMFGH QETPGPDRGS HYSVNLPFLG YSDNPATPDS FIDDFPTDMF DYIESLPSSS  300
EW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-261211525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259182.11e-115PREDICTED: myb-related protein 305-like
TrEMBLD7SLV61e-107D7SLV6_VITVI; Putative uncharacterized protein
STRINGVIT_15s0021g02040.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-68MYB family protein